BTBD9 (NM_152733) Human Recombinant Protein
CAT#: TP319508
Recombinant protein of human BTB (POZ) domain containing 9 (BTBD9), transcript variant 3, 20 µg
View other "BTBD9" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219508 representing NM_152733
Red=Cloning site Green=Tags(s) MRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN IQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLRDSFAAPEKDIFLALLN WCKHNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIA TMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSVINHIRILLWDRDSRSYS YFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEK GLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLL WDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFECPE QQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPNRQHQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 61.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689946 |
| Locus ID | 114781 |
| UniProt ID | Q96Q07 |
| Refseq Size | 1980 |
| Cytogenetics | 6p21.2 |
| Refseq ORF | 1632 |
| Synonyms | dJ322I12.1 |
| Summary | This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011] |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407331 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC409409 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420380 | BTBD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY407331 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 3 |
CNY 4840.00 |
|
| LY409409 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 1 |
CNY 4840.00 |
|
| LY420380 | Transient overexpression lysate of BTB (POZ) domain containing 9 (BTBD9), transcript variant 2 |
CNY 4840.00 |
|
| PH319508 | BTBD9 MS Standard C13 and N15-labeled recombinant protein (NP_689946) |
CNY 14250.00 |
