TREX2 (NM_080701) Human Recombinant Protein
CAT#: TP319499
Recombinant protein of human three prime repair exonuclease 2 (TREX2), 20 µg
View other "TREX2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219499 representing NM_080701
Red=Cloning site Green=Tags(s) MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPF TAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPR DTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLA WADEQARGWAHIEPMYLPPDDPSLEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542432 |
Locus ID | 11219 |
UniProt ID | Q9BQ50 |
Refseq Size | 1255 |
Cytogenetics | Xq28 |
Refseq ORF | 708 |
Summary | This gene encodes a nuclear protein with 3' to 5' exonuclease activity. The encoded protein participates in double-stranded DNA break repair, and may interact with DNA polymerase delta. [provided by RefSeq, Nov 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409112 | TREX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409112 | Transient overexpression lysate of three prime repair exonuclease 2 (TREX2) |
CNY 3080.00 |
|
PH319499 | TREX2 MS Standard C13 and N15-labeled recombinant protein (NP_542432) |
CNY 19520.00 |