CD147 (BSG) (NM_001728) Human Recombinant Protein
CAT＃: TP319464
Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1, 20 µg
View other "CD147" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219464 representing NM_001728
Red=Cloning site Green=Tags(s) MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQL WDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPG TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPM GTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQ GRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001719 |
| Locus ID | 682 |
| UniProt ID | P35613 |
| Refseq Size | 2024 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 1155 |
| Synonyms | 5F7; CD147; EMMPRIN; EMPRIN; HAb18G; OK; TCSF |
| Summary | The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403688 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403695 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419777 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403688 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 |
CNY 3080.00 |
|
| LY403695 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 |
CNY 3080.00 |
|
| LY419777 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 |
CNY 3080.00 |
|
| PH303894 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991) |
CNY 19520.00 |
|
| PH319418 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993) |
CNY 14250.00 |
|
| PH319464 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_001719) |
CNY 19520.00 |
|
| TP303894 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP319418 | Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP720365 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 |
CNY 1800.00 |
BSG (CD147) mouse monoclonal antibody, clone OTI10E10 (formerly 10E10)
