SNURPORTIN1 (SNUPN) (NM_001042581) Human Recombinant Protein
CAT#: TP319409
Recombinant protein of human snurportin 1 (SNUPN), transcript variant 2, 20 µg
View other "SNURPORTIN1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219409 protein sequence
Red=Cloning site Green=Tags(s) MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDW TGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTS AYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHS KLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPY MVSDVLGVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHS PDHPGCLMEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001036046 |
| Locus ID | 10073 |
| UniProt ID | O95149 |
| Refseq Size | 1698 |
| Cytogenetics | 15q24.2 |
| Refseq ORF | 1080 |
| Synonyms | KPNBL; RNUT1; Snurportin1 |
| Summary | The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. The protein encoded by this gene interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor. Alternatively spliced transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417121 | SNUPN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420990 | SNUPN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420996 | SNUPN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417121 | Transient overexpression lysate of snurportin 1 (SNUPN), transcript variant 1 |
CNY 3080.00 |
|
| LY420990 | Transient overexpression lysate of snurportin 1 (SNUPN), transcript variant 2 |
CNY 3080.00 |
|
| LY420996 | Transient overexpression lysate of snurportin 1 (SNUPN), transcript variant 3 |
CNY 3080.00 |
|
| PH301173 | SNUPN MS Standard C13 and N15-labeled recombinant protein (NP_001036053) |
CNY 19520.00 |
|
| PH319363 | SNUPN MS Standard C13 and N15-labeled recombinant protein (NP_005692) |
CNY 19520.00 |
|
| PH319409 | SNUPN MS Standard C13 and N15-labeled recombinant protein (NP_001036046) |
CNY 19520.00 |
|
| TP301173 | Recombinant protein of human snurportin 1 (SNUPN), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP319363 | Recombinant protein of human snurportin 1 (SNUPN), transcript variant 1, 20 µg |
CNY 2900.00 |
其它SNURPORTIN1产品
