CCDC46 (CEP112) (NM_001037325) Human Recombinant Protein
CAT#: TP319337
Recombinant protein of human coiled-coil domain containing 46 (CCDC46), transcript variant 2, 20 µg
View other "CCDC46" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219337 representing NM_001037325
Red=Cloning site Green=Tags(s) MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKL AKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRC AEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGR R myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032402 |
Locus ID | 201134 |
UniProt ID | Q8N8E3 |
Refseq Size | 1258 |
Cytogenetics | 17q24.1 |
Refseq ORF | 633 |
Synonyms | CCDC46; MACOCO; SPGF44 |
Summary | This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate gamma-aminobutyric acid A receptor surface expression. In addition, the protein has been identified as a component of the human centrosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421947 | CEP112 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421947 | Transient overexpression lysate of coiled-coil domain containing 46 (CCDC46), transcript variant 2 |
CNY 3080.00 |
|
PH319337 | CCDC46 MS Standard C13 and N15-labeled recombinant protein (NP_001032402) |
CNY 19520.00 |