TRAF5 (NM_004619) Human Recombinant Protein
CAT#: TP319243
Recombinant protein of human TNF receptor-associated factor 5 (TRAF5), transcript variant 1, 20 µg
View other "TRAF5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219243 protein sequence
Red=Cloning site Green=Tags(s) MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCIL SLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCS NEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDE HLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQ LAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVD TVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQS GKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 64.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004610 |
| Locus ID | 7188 |
| UniProt ID | O00463 |
| Refseq Size | 3988 |
| Cytogenetics | 1q32.3 |
| Refseq ORF | 1671 |
| Synonyms | MGC:39780; RNF84 |
| Summary | The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pathways in cancer, Small cell lung cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407875 | TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC417875 | TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422427 | TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407875 | Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 2 |
CNY 4840.00 |
|
| LY417875 | Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 1 |
CNY 4840.00 |
|
| LY422427 | Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 3 |
CNY 3080.00 |
|
| PH319243 | TRAF5 MS Standard C13 and N15-labeled recombinant protein (NP_004610) |
CNY 19520.00 |
