Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Recombinant Protein
CAT#: TP319231L
Recombinant protein of human thyrotropin-releasing hormone (TRH), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219231 protein sequence
Red=Cloning site Green=Tags(s) MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 27806289) |
| Reference Data | |
| RefSeq | NP_009048 |
| Locus ID | 7200 |
| UniProt ID | P20396 |
| Refseq Size | 1890 |
| Cytogenetics | 3q22.1 |
| Refseq ORF | 726 |
| Synonyms | Pro-TRH; TRF |
| Summary | This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
其它Thyrotropin Releasing Hormone产品
