CHIT1 (NM_003465) Human Recombinant Protein
CAT#: TP319169
Recombinant protein of human chitinase 1 (chitotriosidase) (CHIT1), 20 µg
View other "CHIT1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219169 representing NM_003465
Red=Cloning site Green=Tags(s) MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTE WNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWE YPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLM AYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTR VGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQK GLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFC QGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003456 |
| Locus ID | 1118 |
| UniProt ID | Q13231 |
| Refseq Size | 1633 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 1398 |
| Synonyms | CHI3; CHIT; CHITD |
| Summary | Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. Several alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2012] |
| Protein Families | Secreted Protein, Transmembrane |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401172 | CHIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401172 | Transient overexpression lysate of chitinase 1 (chitotriosidase) (CHIT1) |
CNY 4840.00 |
|
| PH319169 | CHIT1 MS Standard C13 and N15-labeled recombinant protein (NP_003456) |
CNY 19520.00 |
|
| TP720378 | Recombinant protein of human chitinase 1 (chitotriosidase) (CHIT1) |
CNY 1800.00 |
