DYNLRB2 (NM_130897) Human Recombinant Protein
CAT#: TP319143
Recombinant protein of human dynein, light chain, roadblock-type 2 (DYNLRB2), 20 µg
View other "DYNLRB2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219143 representing NM_130897
Red=Cloning site Green=Tags(s) MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR IRSKKHEIMVAPDKEYLLIVIQNPCE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570967 |
Locus ID | 83657 |
UniProt ID | Q8TF09 |
Refseq Size | 506 |
Cytogenetics | 16q23.2 |
Refseq ORF | 288 |
Synonyms | DNCL2B; DNLC2B; ROBLD2 |
Summary | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408882 | DYNLRB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408882 | Transient overexpression lysate of dynein, light chain, roadblock-type 2 (DYNLRB2) |
CNY 3080.00 |
|
PH319143 | DYNLRB2 MS Standard C13 and N15-labeled recombinant protein (NP_570967) |
CNY 19520.00 |
其它DYNLRB2产品