VNN3 (NM_018399) Human Recombinant Protein
CAT#: TP319141
Recombinant protein of human vanin 3 (VNN3), transcript variant 1, 20 µg
View other "VNN3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219141 representing NM_018399
Red=Cloning site Green=Tags(s) MIISHFPKCVAVFALLALSVGALDTFIAAVYEHAVILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAK QGAHIIVTPEDGIYGWIFTRESIYPYLEDIPDPGVNWIPCRDPWRFGNTPVQQRLSCLAKDNSIYVVANI GDKKPCNASDSQCPPDGRYQYNTDVVFDSQGKLLARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIF TCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060869 |
Locus ID | 55350 |
UniProt ID | Q9NY84 |
Refseq Size | 1733 |
Cytogenetics | 6q23.2 |
Refseq ORF | 822 |
Synonyms | HSA238982; MGC124285; MGC171203; OTTMUSP00000022908; PAGEL-beta; PAGEL-eta; PAGEL-zeta; vanin 3; vascular non-inflammatory molecule 3 |
Summary | This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq, Apr 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402675 | VNN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402675 | Transient overexpression lysate of vanin 3 (VNN3), transcript variant 1 |
CNY 3080.00 |
|
PH319141 | VNN3 MS Standard C13 and N15-labeled recombinant protein (NP_060869) |
CNY 19520.00 |