C1orf38 (THEMIS2) (NM_004848) Human Recombinant Protein
CAT#: TP319127
Recombinant protein of human chromosome 1 open reading frame 38 (C1orf38), transcript variant 1, 20 µg
View other "C1orf38" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219127 protein sequence
Red=Cloning site Green=Tags(s) MEPVPLQDFVRALDPASLPRVLRVCSGVYFEGSIYEISGNECCLSTGDLIKVTQVRLQKVVCENPKTSQT MELAPNFQGYFTPLNTPQSYETLEELVSATTQSSKQLPTCFMSTHRIVTEGRVVTEDQLLMLEAVVMHLG IRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEI QAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004839 |
| Locus ID | 9473 |
| UniProt ID | Q5TEJ8 |
| Refseq Size | 1651 |
| Cytogenetics | 1p35.3 |
| Refseq ORF | 780 |
| Synonyms | C1orf38; ICB-1; ICB1 |
| Summary | May constitute a control point in macrophage inflammatory response, promoting LPS-induced TNF production.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417704 | THEMIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426270 | THEMIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417704 | Transient overexpression lysate of chromosome 1 open reading frame 38 (C1orf38), transcript variant 1 |
CNY 3080.00 |
|
| LY426270 | Transient overexpression lysate of chromosome 1 open reading frame 38 (C1orf38), transcript variant 3 |
CNY 3080.00 |
|
| PH319127 | C1orf38 MS Standard C13 and N15-labeled recombinant protein (NP_004839) |
CNY 19520.00 |
其它C1orf38产品
