Nucleolin (NCL) (NM_005381) Human Recombinant Protein
CAT#: TP319082
Recombinant protein of human nucleolin (NCL), 20 µg
View other "Nucleolin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 12 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219082 representing NM_005381
Red=Cloning site Green=Tags(s) MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTK KVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNA KKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEA METTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR KKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFG YVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVL SNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAM EDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDH KPQGKKTKFE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 76.4 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA reaction positive control (PMID: 26354862) Taq polymerase assay (regulator) (PMID: 26354862) Binding assay (Dimethylsulfate footprinting) (PMID: 26354862) Binding assay (FRET) (PMID: 26354862) Surface Plasmon Ressonance (SPR) (PMID: 26354862) Association in cell culture (PMID: 26707270) Surface Plasmon Ressonance (SPR) (PMID: 27032748) EMSA reaction positive control (PMID: 27913192) ELISA binding assay (PMID: 28974366) |
Reference Data | |
RefSeq | NP_005372 |
Locus ID | 4691 |
UniProt ID | P19338 |
Refseq Size | 2732 |
Cytogenetics | 2q37.1 |
Refseq ORF | 2130 |
Synonyms | C23; Nsr1 |
Summary | Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb. The intron 11 of the NCL gene encodes a small nucleolar RNA, termed U20. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Pathogenic Escherichia coli infection |
Citations (12)
The use of this Proteins has been cited in the following citations: |
---|
Development of RNA G-quadruplex (rG4)-targeting L-RNA aptamers by rG4-SELEX.
,null,
Nature protocols
,PubMed ID 35444329
[Nucleolin]
|
Cell surface nucleolin is a novel ADAMTS5 receptor mediating endothelial cell apoptosis
,null,
Cell Death & Disease
,PubMed ID 35197459
[Nucleolin]
|
Toward G-Quadruplex-Based Anticancer Agents: Biophysical and Biological Studies of Novel AS1411 Derivatives
,Ogloblina, AM;Iaccarino, N;Capasso, D;Di Gaetano, S;Garzarella, EU;Dolinnaya, NG;Yakubovskaya, MG;Pagano, B;Amato, J;Randazzo, A;,
Int J Mol Sci
,PubMed ID 33096752
[Nucleolin]
|
Specific suppression of D-RNA G-quadruplex-protein interaction with an L-RNA aptamer
,Umar, MI;Kwok, CK;,
Nucleic Acids Res.
,PubMed ID 32976590
[Nucleolin]
|
A novel nucleolin-binding peptide for Cancer Theranostics
,Kim, JH;Bae, C;Kim, MJ;Song, IH;Ryu, JH;Choi, JH;Lee, CJ;Nam, JS;Kim, JI;,
Theranostics
,PubMed ID 32802184
[Nucleolin]
|
Aberrant expression of CITED2 promotes prostate cancer metastasis by activating the nucleolin-AKT pathway
,Shin, SH;Lee, GY;Lee, M;Kang, J;Shin, HW;Chun, YS;Park, JW;,
Nat Commun
,PubMed ID 30291252
[Nucleolin]
|
Human CCDC47 sandwich immunoassay development with electrochemiluminescence technology
,Wu, WS;Zhu, L;Patil, S;Gokul, K;Reilly, S;Chan, J;Tekumalla, P;Vishnudas, V;Kiebish, MA;Sarangarajan, R;Akmaev, VR;Kellogg, MD;Narain, NR;,
J. Immunol. Methods
,PubMed ID 28974366
[Nucleolin]
|
A common intronic variant of PARP1 confers melanoma risk and mediates melanocyte growth via regulation of MITF.
,null,
Nature genetics
,PubMed ID 28759004
[Nucleolin]
|
The cellular protein nucleolin preferentially binds long-looped G-quadruplex nucleic acids
,Lago, S;Tosoni, E;Nadai, M;Palumbo, M;Richter, SN;,
Biochim. Biophys. Acta
,PubMed ID 27913192
[Nucleolin]
|
The G-quadruplex-forming aptamer AS1411 potently inhibits HIV-1 attachment to the host cell
,Perrone, R;Butovskaya, E;Lago, S;Garzino-Demo, A;Pannecouque, C;Palù, G;Richter, SN;,
Int. J. Antimicrob. Agents
,PubMed ID 27032748
[Nucleolin]
|
Nucleolin promotes in vitro translation of feline calicivirus genomic RNA
,Hernández, BA;Sandoval-Jaime, C;Sosnovtsev, SV;,
Virology
,PubMed ID 26707270
[Nucleolin]
|
Nucleolin stabilizes G-quadruplex structures folded by the LTR promoter and silences HIV-1 viral transcription
,Tosoni, E;Frasson, I;Scalabrin, M;Perrone, R;Butovskaya, E;Nadai, M;Palù, G;Fabris, D;Richter, SN;,
Nucleic Acids Res.
,PubMed ID 26354862
[Nucleolin]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
其它Nucleolin产品