ERG (NM_004449) Human Recombinant Protein
CAT#: TP318892
Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 2, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC218892
Blue=ORF Red=Cloning site Green=Tag(s) MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPA RVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADP TLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPL PHLTSDDVDKALQNSPRLMHARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPY QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNY DKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQKMNFV APHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV Recombinant protein using RC218892 also available, TP318892 |
| Tag | C-Myc/DDK |
| Predicted MW | 51.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004440 |
| Locus ID | 2078 |
| UniProt ID | P11308 |
| Refseq Size | 3097 |
| Cytogenetics | 21q22.2 |
| Refseq ORF | 1386 |
| Synonyms | erg-3; p55 |
| Summary | This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Apr 2014] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401413 | ERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403650 | ERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427827 | ERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401413 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 2 |
CNY 4840.00 |
|
| LY403650 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 1 |
CNY 3080.00 |
|
| LY427827 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 3 |
CNY 3080.00 |
|
| PH308093 | ERG MS Standard C13 and N15-labeled recombinant protein (NP_891548) |
CNY 19520.00 |
|
| PH318892 | ERG MS Standard C13 and N15-labeled recombinant protein (NP_004440) |
CNY 19520.00 |
|
| TP308093 | Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 1, 20 µg |
CNY 2900.00 |


