HSPA14 (NM_016299) Human Recombinant Protein
CAT#: TP318858
Recombinant protein of human heat shock 70kDa protein 14 (HSPA14), transcript variant 1, 20 µg
View other "HSPA14" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218858 protein sequence
Red=Cloning site Green=Tags(s) MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQI LGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVV ITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTSLSLSVMEV NSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANC FLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKD LFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHV TCTDQETGKCEAISIEIAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057383 |
| Locus ID | 51182 |
| UniProt ID | Q0VDF9 |
| Refseq Size | 1921 |
| Cytogenetics | 10p13 |
| Refseq ORF | 1527 |
| Synonyms | HSP70-4; HSP70L1 |
| Summary | Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414070 | HSPA14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY414070 | Transient overexpression lysate of heat shock 70kDa protein 14 (HSPA14), transcript variant 1 |
CNY 4840.00 |
|
| PH318858 | HSPA14 MS Standard C13 and N15-labeled recombinant protein (NP_057383) |
CNY 19520.00 |
|
| TP761229 | Purified recombinant protein of Human heat shock 70kDa protein 14 (HSPA14), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
