ADAMTSL1 (NM_052866) Human Recombinant Protein
CAT#: TP318828
Purified recombinant protein of Homo sapiens ADAMTS-like 1 (ADAMTSL1), transcript variant 2, 20 µg
View other "ADAMTSL1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218828 representing NM_052866
Red=Cloning site Green=Tags(s) MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRN IRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLD GTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPY GSRHIRLVLKGPDHLYLETKTLQGTKGENSLNSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIR NSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPK LQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC MYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKPHIKEECIVPT PCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPS SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 55.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443098 |
Locus ID | 92949 |
UniProt ID | Q8N6G6 |
Refseq Size | 1810 |
Cytogenetics | 9p22.2-p22.1 |
Refseq ORF | 1575 |
Synonyms | ADAMTSL-1; ADAMTSR1; C9orf94; PUNCTIN |
Summary | This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Shipping | Dry Ice |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409424 | ADAMTSL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY409424 | Transient overexpression lysate of ADAMTS-like 1 (ADAMTSL1), transcript variant 2 |
CNY 4840.00 |
|
PH318828 | ADAMTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_443098) |
CNY 14250.00 |
|
TP761080 | Purified recombinant protein of Human ADAMTS-like 1 (ADAMTSL1), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它ADAMTSL1产品