OSCP1 (NM_145047) Human Recombinant Protein
CAT#: TP318808
Recombinant protein of human chromosome 1 open reading frame 102 (C1orf102), transcript variant 1, 20 µg
View other "OSCP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218808 representing NM_145047
Red=Cloning site Green=Tags(s) MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTV YERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETL RQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFN NKGEEVKRIEFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNP LAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELA RIMGEFEITEQPRLSTSKGDDLLAMMDEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_659484 |
| Locus ID | 127700 |
| UniProt ID | Q8WVF1 |
| Refseq Size | 1502 |
| Cytogenetics | 1p34.3 |
| Refseq ORF | 1137 |
| Synonyms | C1orf102; NOR1 |
| Summary | May be involved in drug clearance in the placenta.[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
In vivo tunable CRISPR mediates efficient somatic mutagenesis to generate tumor models
,An, X;Li, L;Wu, S;,
Protein Cell
,PubMed ID 30269252
[OSCP1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408064 | OSCP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408064 | Transient overexpression lysate of organic solute carrier partner 1 (OSCP1), transcript variant 1 |
CNY 3080.00 |
|
| PH318808 | OSCP1 MS Standard C13 and N15-labeled recombinant protein (NP_659484) |
CNY 19520.00 |
