PSORS1C1 (NM_014068) Human Recombinant Protein
CAT#: TP318532
Recombinant protein of human psoriasis susceptibility 1 candidate 1 (PSORS1C1), 20 µg
View other "PSORS1C1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218532 representing NM_014068
Red=Cloning site Green=Tags(s) MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFH LAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSP PSHSPFGLSSLI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054787 |
Locus ID | 170679 |
UniProt ID | Q9UIG5 |
Refseq Size | 861 |
Cytogenetics | 6p21.33 |
Refseq ORF | 456 |
Synonyms | C6orf16; SEEK1 |
Summary | This gene is one of several genes thought to confer susceptibility to psoriasis and systemic sclerosis, located on chromosome 6 near the major histocompatibility complex (MHC) class I region. [provided by RefSeq, Sep 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415493 | PSORS1C1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415493 | Transient overexpression lysate of psoriasis susceptibility 1 candidate 1 (PSORS1C1) |
CNY 3080.00 |
|
PH318532 | PSORS1C1 MS Standard C13 and N15-labeled recombinant protein (NP_054787) |
CNY 19520.00 |
其它PSORS1C1产品