CaMKI (CAMK1) (NM_003656) Human Recombinant Protein
CAT#: TP318464
Recombinant protein of human calcium/calmodulin-dependent protein kinase I (CAMK1), 20 µg
View other "CaMKI" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218464 representing NM_003656
Red=Cloning site Green=Tags(s) MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVL HKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHR DLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDT ALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCC CRDCCVEPGTELSPTLPHQL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003647 |
| Locus ID | 8536 |
| UniProt ID | Q14012 |
| Refseq Size | 1501 |
| Cytogenetics | 3p25.3 |
| Refseq ORF | 1110 |
| Synonyms | CAMKI |
| Summary | Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401210 | CAMK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401210 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase I (CAMK1) |
CNY 3080.00 |
|
| PH318464 | CAMK1 MS Standard C13 and N15-labeled recombinant protein (NP_003647) |
CNY 19520.00 |
