SNRPC (NM_003093) Human Recombinant Protein
CAT#: TP318418
Recombinant protein of human small nuclear ribonucleoprotein polypeptide C (SNRPC), 20 µg
View other "SNRPC" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218418 representing NM_003093
Red=Cloning site Green=Tags(s) MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR PPARPMMVPTRPGMTRPDR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003084 |
Locus ID | 6631 |
UniProt ID | P09234 |
Refseq Size | 733 |
Cytogenetics | 6p21.31 |
Refseq ORF | 477 |
Synonyms | U1C; Yhc1 |
Summary | This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.[provided by RefSeq, Oct 2009] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The process of somatic hypermutation increases polyreactivity for central nervous system antigens in primary central nervous system lymphoma
,Montesinos-Rongen, M;Terrao, M;May, C;Marcus, K;Blümcke, I;Hellmich, M;Küppers, R;Brunn, A;Deckert, M;,
Haematologica
,PubMed ID 32193251
[SNRPC]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418904 | SNRPC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418904 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide C (SNRPC), transcript variant 1 |
CNY 3080.00 |
|
PH318418 | SNRPC MS Standard C13 and N15-labeled recombinant protein (NP_003084) |
CNY 19520.00 |