CABP (CABP1) (NM_031205) Human Recombinant Protein
CAT#: TP318317
Recombinant protein of human calcium binding protein 1 (CABP1), transcript variant 1, 20 µg
View other "CABP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218317 representing NM_031205
Red=Cloning site Green=Tags(s) MGNCVKYPLRNLSRKMCQEEQTSYMVVQTSEEGLAADAELPGPLLMLAQNCAVMHNLLGPACIFLRKGFA ENRQPDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDF DDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDL NGDGRVDFEEFVRMMSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112482 |
Locus ID | 9478 |
UniProt ID | Q9NZU7 |
Refseq Size | 1201 |
Cytogenetics | 12q24.31 |
Refseq ORF | 681 |
Synonyms | CALBRAIN; HCALB_BR |
Summary | Calcium binding proteins are an important component of calcium mediated cellular signal transduction. This gene encodes a protein that belongs to a subfamily of calcium binding proteins which share similarity to calmodulin. The protein encoded by this gene regulates the gating of voltage-gated calcium ion channels. This protein inhibits calcium-dependent inactivation and supports calcium-dependent facilitation of ion channels containing voltage-dependent L-type calcium channel subunit alpha-1C. This protein also regulates calcium-dependent activity of inositol 1,4,5-triphosphate receptors, P/Q-type voltage-gated calcium channels, and transient receptor potential channel TRPC5. This gene is predominantly expressed in retina and brain. Alternative splicing results in multiple transcript variants encoding disinct isoforms. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410585 | CABP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410585 | Transient overexpression lysate of calcium binding protein 1 (CABP1), transcript variant 1 |
CNY 3080.00 |
|
PH318317 | CABP1 MS Standard C13 and N15-labeled recombinant protein (NP_112482) |
CNY 19520.00 |