Sterol carrier protein 2 (SCP2) (NM_001007100) Human Recombinant Protein
CAT#: TP318251
Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 4, 20 µg
View other "Sterol carrier protein 2" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218251 representing NM_001007100
Red=Cloning site Green=Tags(s) MGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVD VKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001007101 |
| Locus ID | 6342 |
| UniProt ID | P22307 |
| Refseq Size | 1438 |
| Cytogenetics | 1p32.3 |
| Refseq ORF | 420 |
| Synonyms | NLTP; NSL-TP; SCOX; SCP-2; SCP-CHI; SCP-X; SCPX |
| Summary | This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010] |
| Protein Pathways | Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401042 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422797 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422798 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434253 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434278 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434294 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401042 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 1 |
CNY 4840.00 |
|
| LY422797 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 3 |
CNY 3080.00 |
|
| LY422798 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 4 |
CNY 3080.00 |
|
| LY434253 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 8 |
CNY 3080.00 |
|
| LY434278 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 6 |
CNY 3080.00 |
|
| LY434294 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 7 |
CNY 3080.00 |
|
| PH318251 | SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_001007101) |
CNY 19520.00 |
|
| PH319802 | SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_002970) |
CNY 19520.00 |
|
| TP319802 | Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Sterol carrier protein 2产品
