CAMK2A (NM_015981) Human Recombinant Protein
CAT#: TP318186
Recombinant protein of human calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 1, 20 µg
View other "CAMK2A" proteins (5)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC218186 representing NM_015981 Red=Cloning site Green=Tags(s) MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIE DEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 55.1 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | Enzyme activity regulator (PMID: 29486595) | 
| Reference Data | |
| RefSeq | NP_057065 | 
| Locus ID | 815 | 
| UniProt ID | A8K161 | 
| Refseq Size | 4836 | 
| Cytogenetics | 5q32 | 
| Refseq ORF | 1467 | 
| Synonyms | CAMKA; CaMKIIalpha; CaMKIINalpha; MRD53; MRT63 | 
| Summary | The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2018] | 
| Protein Families | Druggable Genome, Protein Kinase | 
| Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway | 
Citations (2)
| The use of this Proteins has been cited in the following citations: | 
|---|
| Identification of Synaptic DGKθ Interactors That Stimulate DGKθ Activity
                                                ,null,
                                                Frontiers in Synaptic Neuroscience
                                                ,PubMed ID 35573662
                                                [CAMK2A] | 
| Critical roles of Carbon Monoxide and Nitric Oxide in Ca2+ Signaling for Insulin Secretion in Pancreatic Islets
                                                ,Rahman, FU;Park, DR;Joe, Y;Jang, KY;Chung, HT;Kim, UH;,
                                                Antioxid. Redox Signal.
                                                ,PubMed ID 29486595
                                                [CAMK2A] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC406882 | CAMK2A HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY406882 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 2 | CNY 3080.00 | |
| PH305202 | CAMK2A MS Standard C13 and N15-labeled recombinant protein (NP_741960) | CNY 19520.00 | |
| PH318186 | CAMK2A MS Standard C13 and N15-labeled recombinant protein (NP_057065) | CNY 14250.00 | |
| TP305202 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II alpha (CAMK2A), transcript variant 2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 


 
                        
 
        