SIRT1 (NM_012238) Human Recombinant Protein
CAT#: TP318134
Recombinant protein of human sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), transcript variant 1, 20 µg
View other "SIRT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218134 representing NM_012238
Red=Cloning site Green=Tags(s) MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGA AAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAI GYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETI PPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIY ARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTL EQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELC HRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAA KSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAK EQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYN GLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 81.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036370 |
| Locus ID | 23411 |
| UniProt ID | Q96EB6 |
| Refseq Size | 4107 |
| Cytogenetics | 10q21.3 |
| Refseq ORF | 2241 |
| Synonyms | SIR2; SIR2alpha; SIR2L1 |
| Summary | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Rescue of retinal ganglion cells in optic nerve injury using cell-selective AAV mediated delivery of SIRT1
,Ross, AG;McDougald, DS;Khan, RS;Duong, TT;Dine, KE;Aravand, P;Bennett, J;Chavali, VRM;Shindler, KS;,
Gene therapy
,PubMed ID 33589779
[SIRT1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402173 | SIRT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402173 | Transient overexpression lysate of sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), transcript variant 1 |
CNY 4840.00 |
|
| PH318134 | SIRT1 MS Standard C13 and N15-labeled recombinant protein (NP_036370) |
CNY 19520.00 |


