MLIP (NM_138569) Human Recombinant Protein
CAT#: TP318122
Recombinant protein of human chromosome 6 open reading frame 142 (C6orf142), 20 µg
View other "MLIP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218122 representing NM_138569
Red=Cloning site Green=Tags(s) MELEKREKRSLLNKNLEEKLTVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPET VNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDE AASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKS SYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHS SDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEE VYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFS LSDEQENSHTLLSHNACNKLSHPMVAIPEHEALDSKEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_612636 |
| Locus ID | 90523 |
| UniProt ID | Q5VWP3 |
| Refseq Size | 1740 |
| Cytogenetics | 6p12.1 |
| Refseq ORF | 1374 |
| Synonyms | C6orf142; CIP |
| Summary | Required for precocious cardiac adaptation to stress through integrated regulation of the AKT/mTOR pathways and FOXO1. Regulates cardiac homeostasis and plays an important role in protection against cardiac hypertrophy. Acts as a transcriptional cofactor, represses transactivator activity of ISL1 and MYOCD.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408572 | MLIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408572 | Transient overexpression lysate of chromosome 6 open reading frame 142 (C6orf142) |
CNY 4840.00 |
|
| PH318122 | C6orf142 MS Standard C13 and N15-labeled recombinant protein (NP_612636) |
CNY 19520.00 |
