XRCC4 (NM_022550) Human Recombinant Protein
CAT#: TP318029
Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, 20 µg
View other "XRCC4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218029 representing NM_022550
Red=Cloning site Green=Tags(s) MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_072044 |
| Locus ID | 7518 |
| UniProt ID | Q13426 |
| Refseq Size | 1707 |
| Cytogenetics | 5q14.2 |
| Refseq ORF | 1008 |
| Synonyms | SSMED |
| Summary | The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. [provided by RefSeq, Oct 2019] |
| Protein Families | Druggable Genome |
| Protein Pathways | Non-homologous end-joining |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Quantification of XRCC and DNA-PK proteins in cancer cell lines and human tumors by LC-MS/MS
,Myers, MV;Maxwell, SE;Wang, X;,
Bioanalysis
,PubMed ID 24785829
[XRCC4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402930 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418718 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402930 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 |
CNY 3080.00 |
|
| LY418718 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1 |
CNY 3080.00 |
|
| PH312684 | XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_003392) |
CNY 19520.00 |
|
| PH318029 | XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_072044) |
CNY 19520.00 |
|
| TP312684 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1, 20 µg |
CNY 2900.00 |
