TRIM72 (NM_001008274) Human Recombinant Protein
CAT#: TP318023
Recombinant protein of human tripartite motif-containing 72 (TRIM72), 20 µg
View other "TRIM72" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218023 representing NM_001008274
Red=Cloning site Green=Tags(s) MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQ LARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQL QEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGEAGVALRRELG SLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKM FRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVD VGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFG DGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008275 |
Locus ID | 493829 |
UniProt ID | Q6ZMU5 |
Refseq Size | 2098 |
Cytogenetics | 16p11.2 |
Refseq ORF | 1431 |
Synonyms | MG53 |
Summary | Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of the repair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membrane damage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization at the injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to the injury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealing process. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membrane budding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423413 | TRIM72 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY423413 | Transient overexpression lysate of tripartite motif-containing 72 (TRIM72) |
CNY 4840.00 |
|
PH318023 | TRIM72 MS Standard C13 and N15-labeled recombinant protein (NP_001008275) |
CNY 14250.00 |
|
TP750051 | Purified recombinant protein of Human MG53,full length, expressed in E. coli,50ug |
CNY 3010.00 |
|
TP750052 | Purified recombinant protein of Human MG53, mutant Cys14Ala, expressed in E. coli,50ug |
CNY 3010.00 |
|
TP750131 | Purified recombinant protein of Human MG53,Ala123-Ala477, expressed in E. coli,50ug |
CNY 3010.00 |
|
TP750134 | Purified recombinant protein of Human MG53,Met1-Asp270, expressed in E. coli,50ug |
CNY 3010.00 |
|
TP750135 | Purified recombinant protein of Human MG53,Asp271-Ala477, expressed in E. coli,50ug |
CNY 3010.00 |
|
TP750136 | Purified recombinant protein of Human MG53, Ala58-End, tag free, expressed in E.coli, 50ug |
CNY 2926.00 |