DEFB131A (NM_001040448) Human Recombinant Protein
CAT#: TP318014
Recombinant protein of human defensin, beta 131 (DEFB131), 20 µg
View other "DEFB131A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218014 representing NM_001040448
Red=Cloning site Green=Tags(s) MRVLFFVFGVLSLMFTVPPGRSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035538 |
Locus ID | 644414 |
UniProt ID | P59861 |
Refseq Size | 213 |
Cytogenetics | 4p16.1 |
Refseq ORF | 210 |
Synonyms | DEFB-31; DEFB131 |
Summary | Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 4p16. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421765 | DEFB131 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421765 | Transient overexpression lysate of defensin, beta 131 (DEFB131) |
CNY 3080.00 |
|
PH318014 | DEFB131 MS Standard C13 and N15-labeled recombinant protein (NP_001035538) |
CNY 19520.00 |
其它DEFB131A产品