hnRNP Q (SYNCRIP) (NM_006372) Human Recombinant Protein
CAT#: TP317902
Purified recombinant protein of Human synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
View other "hnRNP Q" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7110.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217902 representing NM_006372
Red=Cloning site Green=Tags(s) MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNE DGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTG QRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTF CTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPD DKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVT EEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYED FQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGN VGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | Myc-DDK |
| Predicted MW | 69.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate Bradford method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006363 |
| Locus ID | 10492 |
| UniProt ID | O60506 |
| Refseq Size | 2932 |
| Cytogenetics | 6q14.3 |
| Refseq ORF | 1869 |
| Synonyms | GRY-RBP; GRYRBP; hnRNP-Q; HNRNPQ; HNRPQ1; NSAP1; PP68 |
| Summary | This gene encodes a member of the cellular heterogeneous nuclear ribonucleoprotein (hnRNP) family. hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. The encoded protein plays a role in multiple aspects of mRNA maturation and is associated with several multiprotein complexes including the apoB RNA editing-complex and survival of motor neurons (SMN) complex. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 20. [provided by RefSeq, Dec 2011] |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416691 | SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431415 | SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431483 | SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431486 | SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431504 | SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416691 | Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 1 |
CNY 4840.00 |
|
| LY431415 | Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 2 |
CNY 3080.00 |
|
| LY431483 | Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 5 |
CNY 3080.00 |
|
| LY431486 | Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 6 |
CNY 3080.00 |
|
| LY431504 | Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 4 |
CNY 3080.00 |
其它hnRNP Q产品
