ING1 (NM_198219) Human Recombinant Protein
CAT#: TP317763
Recombinant protein of human inhibitor of growth family, member 1 (ING1), transcript variant 1, 20 µg
View other "ING1" proteins (11)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC217763 protein sequence 
Red=Cloning site Green=Tags(s) MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRM LHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA QADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 31.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_937862 | 
| Locus ID | 3621 | 
| UniProt ID | Q9UK53 | 
| Refseq Size | 2887 | 
| Cytogenetics | 13q34 | 
| Refseq ORF | 837 | 
| Synonyms | p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a | 
| Summary | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Transcription Factors | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403677 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC404951 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC417242 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LC429254 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC430724 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY403677 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY404951 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY417242 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 4 | 
                                                     CNY 4840.00  | 
                                            |
| LY430724 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| PH317763 | ING1 MS Standard C13 and N15-labeled recombinant protein (NP_937862) | 
                                                     CNY 19520.00  | 
                                            |
| TP760507 | Purified recombinant protein of Human inhibitor of growth family, member 1 (ING1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 
                                                     CNY 2040.00  | 
                                            
