ARMCX3 (NM_177947) Human Recombinant Protein
CAT#: TP317732
Recombinant protein of human armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 2, 20 µg
View other "ARMCX3" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217732 protein sequence
Red=Cloning site Green=Tags(s) MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNES KSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILE AALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDD TITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTREL LRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGI ESHHDFLVKVKVGKFMAKLAEHMFPKSQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_808816 |
Locus ID | 51566 |
UniProt ID | Q9UH62 |
Refseq Size | 3367 |
Cytogenetics | Xq22.1 |
Refseq ORF | 1137 |
Synonyms | ALEX3; dJ545K15.2; GASP6 |
Summary | This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406053 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406054 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413862 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429505 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406053 | Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 2 |
CNY 3080.00 |
|
LY406054 | Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 3 |
CNY 3080.00 |
|
LY413862 | Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 1 |
CNY 3080.00 |
|
PH317732 | ARMCX3 MS Standard C13 and N15-labeled recombinant protein (NP_808816) |
CNY 19520.00 |