PSG8 (NM_182707) Human Recombinant Protein
CAT#: TP317726
Purified recombinant protein of Homo sapiens pregnancy specific beta-1-glycoprotein 8 (PSG8), transcript variant 1, 20 µg
View other "PSG8" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217726 representing NM_182707
Red=Cloning site Green=Tags(s) MGLLSAPPCTQRITWKGLLLTASLLNFWNPPTTAQVTIEAQPTKVSEGKDVLLLVHNLPQNLTGYIWYKG QIRDLYHYITSYVVDGQIIIYGPAYSGRETIYSNASLLIQNVTQEDAGSYTLHIIMGGDENRGVTGHFTF TLYLETPKPSISSSKLNPREAMEAVSLTCDPETPDASYLWWMNGQSLPMSHRLQLSETNRTLFLLGVTKY TAGPYECEIRNPVSASRSDPFTLNLLPKLPKPYITINNLKPRENKDVLNFTCEPKSENYTYIWWLNGQSL PVSPRVKRPIENRILILPSVTRNETGPYQCEIRDQYGGIRSYPVTLNVLYGPDLPRIYPSFTYYRSGEVL YLSCSADSNPPAQYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIPV SLAIGI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_874366 |
Locus ID | 440533 |
UniProt ID | Q9UQ74 |
Refseq Size | 1281 |
Cytogenetics | 19q13.2 |
Refseq ORF | 1278 |
Synonyms | PSG1 |
Summary | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427192 | PSG8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427193 | PSG8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427192 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 8 (PSG8), transcript variant 2 |
CNY 3080.00 |
|
LY427193 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 8 (PSG8), transcript variant 3 |
CNY 3080.00 |
|
PH317726 | PSG8 MS Standard C13 and N15-labeled recombinant protein (NP_874366) |
CNY 14250.00 |