TRARG1 (NM_172367) Human Recombinant Protein
CAT#: TP317523
Purified recombinant protein of Homo sapiens tumor suppressor candidate 5 (TUSC5), 20 µg
View other "TRARG1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217523 representing NM_172367
Red=Cloning site Green=Tags(s) MAHPVQSEFPSAQEPGSAASLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNGQGLPFKAISEGHL EAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVD GARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 19.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_758955 |
Locus ID | 286753 |
UniProt ID | Q8IXB3 |
Refseq Size | 3616 |
Cytogenetics | 17p13.3 |
Refseq ORF | 531 |
Synonyms | BEC-1; DSPB1; IFITMD3; LOST1; TUSC5 |
Summary | Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged insulin stimulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406733 | TUSC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406733 | Transient overexpression lysate of tumor suppressor candidate 5 (TUSC5) |
CNY 3080.00 |
|
PH317523 | TUSC5 MS Standard C13 and N15-labeled recombinant protein (NP_758955) |
CNY 14250.00 |