CEACAM3 (NM_001815) Human Recombinant Protein
CAT#: TP317469
Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), 20 µg
View other "CEACAM3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217469 protein sequence
Red=Cloning site Green=Tags(s) MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001806 |
Locus ID | 1084 |
UniProt ID | P40198 |
Refseq Size | 1163 |
Cytogenetics | 19q13.2 |
Refseq ORF | 756 |
Synonyms | CD66D; CEA; CGM1; W264; W282 |
Summary | This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2013] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419723 | CEACAM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419723 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) |
CNY 3080.00 |
|
PH317469 | CEACAM3 MS Standard C13 and N15-labeled recombinant protein (NP_001806) |
CNY 19520.00 |
|
TP720376 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) |
CNY 1800.00 |
其它CEACAM3产品