HFE (NM_000410) Human Recombinant Protein
CAT＃: TP317447
Recombinant protein of human hemochromatosis (HFE), transcript variant 1, 20 µg
View other "HFE" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217447 representing NM_000410
Red=Cloning site Green=Tags(s) MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLV KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000401 |
| Locus ID | 3077 |
| UniProt ID | Q30201 |
| Refseq Size | 2727 |
| Cytogenetics | 6p22.2 |
| Refseq ORF | 1044 |
| Synonyms | HFE1; HH; HLA-H; MVCD7; TFQTL2 |
| Summary | The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408433 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408436 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424725 | HFE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408433 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 6 |
CNY 3080.00 |
|
| LY408436 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 9 |
CNY 3080.00 |
|
| LY424725 | Transient overexpression lysate of hemochromatosis (HFE), transcript variant 1 |
CNY 3080.00 |
|
| PH317447 | HFE MS Standard C13 and N15-labeled recombinant protein (NP_000401) |
CNY 19520.00 |
|
| PH319316 | HFE MS Standard C13 and N15-labeled recombinant protein (NP_620575) |
CNY 14250.00 |
|
| PH319465 | HFE MS Standard C13 and N15-labeled recombinant protein (NP_620578) |
CNY 14250.00 |
|
| TP319316 | Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP319465 | Purified recombinant protein of Homo sapiens hemochromatosis (HFE), transcript variant 9, 20 µg |
CNY 2900.00 |
HFE Rabbit Polyclonal Antibody
热销推荐
