CCDC153 (NM_001033658) Human Recombinant Protein
CAT#: TP317435
Recombinant protein of human coiled-coil domain containing 153 (CCDC153), 20 µg
View other "CCDC153" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217435 representing NM_001033658
Red=Cloning site Green=Tags(s) MSRQCHALQEDMQTHSKQLEEEVKGLRGQLEACQREAAAAREEAEQALGERDQALAQLRAHMADMEAKYE EILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028830 |
Locus ID | 283152 |
UniProt ID | Q494R4 |
Refseq Size | 625 |
Cytogenetics | 11q23.3 |
Refseq ORF | 372 |
Synonyms | coiled-coil domain containing 153; MGC125447; MGC125447, MGC125448; MGC125448 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422411 | CCDC153 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422411 | Transient overexpression lysate of coiled-coil domain containing 153 (CCDC153) |
CNY 3080.00 |
|
PH317435 | CCDC153 MS Standard C13 and N15-labeled recombinant protein (NP_001028830) |
CNY 19520.00 |
其它CCDC153产品