FAM36A (COX20) (NM_198076) Human Recombinant Protein
CAT#: TP317381
Recombinant protein of human family with sequence similarity 36, member A (FAM36A), 20 µg
View other "FAM36A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217381 protein sequence
Red=Cloning site Green=Tags(s) MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVT LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_932342 |
| Locus ID | 116228 |
| UniProt ID | Q5RI15 |
| Refseq Size | 2632 |
| Cytogenetics | 1q44 |
| Refseq ORF | 354 |
| Synonyms | FAM36A; MC4DN11 |
| Summary | This gene encodes a protein that plays a role in the assembly of cytochrome C oxidase, an important component of the respiratory pathway. It contains two transmembrane helices and localizes to the mitochondrial membrane. Mutations in this gene can cause mitochondrial complex IV deficiency, which results in ataxia and muscle hypotonia. There are multiple pseudogenes for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405090 | COX20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405090 | Transient overexpression lysate of family with sequence similarity 36, member A (FAM36A) |
CNY 3080.00 |
|
| PH317381 | FAM36A MS Standard C13 and N15-labeled recombinant protein (NP_932342) |
CNY 19520.00 |
