THYN1 (NM_001037305) Human Recombinant Protein
CAT#: TP317369
Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 5, 20 µg
View other "THYN1" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217369 representing NM_001037305
Red=Cloning site Green=Tags(s) MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF EKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQ EEFDFVLSLEEKEPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001032382 |
| Locus ID | 29087 |
| UniProt ID | Q9P016 |
| Refseq Size | 941 |
| Cytogenetics | 11q25 |
| Refseq ORF | 675 |
| Synonyms | HSPC144; MDS012; MY105; THY28; THY28KD |
| Summary | This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404616 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404617 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415464 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421943 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421944 | THYN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404616 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 2 |
CNY 3080.00 |
|
| LY404617 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 3 |
CNY 3080.00 |
|
| LY415464 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 1 |
CNY 3080.00 |
|
| LY421943 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 4 |
CNY 3080.00 |
|
| LY421944 | Transient overexpression lysate of thymocyte nuclear protein 1 (THYN1), transcript variant 5 |
CNY 3080.00 |
|
| PH316877 | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_054893) |
CNY 19520.00 |
|
| PH317369 | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_001032382) |
CNY 19520.00 |
|
| PH322714 | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_954994) |
CNY 19520.00 |
|
| TP316877 | Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP322714 | Recombinant protein of human thymocyte nuclear protein 1 (THYN1), transcript variant 2, 20 µg |
CNY 2900.00 |
