LY6G6F (NM_001003693) Human Recombinant Protein
CAT#: TP317067
Recombinant protein of human lymphocyte antigen 6 complex, locus G6F (LY6G6F), 20 µg
View other "LY6G6F" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217067 representing NM_001003693
Red=Cloning site Green=Tags(s) MAVLFLLLFLCGTPQAADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRP APDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSP CNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGV SFSLAASIDASPALCAPSTGWDMPWILMLLLTMGQGVVILALSIVLWRQRVRGAPGRDASIPQFKPEIQV YENIHLARLGPPAHKPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001003693 |
Locus ID | 259215 |
UniProt ID | Q5SQ64 |
Refseq Size | 898 |
Cytogenetics | 6p21.33 |
Refseq ORF | 891 |
Synonyms | C6orf21; G6f; LY6G6; LY6G6D; NG32 |
Summary | The human G6f protein is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition (de Vet et al., 2003 [PubMed 12852788]).[supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423981 | LY6G6F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423981 | Transient overexpression lysate of lymphocyte antigen 6 complex, locus G6F (LY6G6F) |
CNY 3080.00 |
|
PH317067 | LY6G6F MS Standard C13 and N15-labeled recombinant protein (NP_001003693) |
CNY 19520.00 |