DEFB113 (NM_001037729) Human Recombinant Protein
CAT#: TP316994
Purified recombinant protein of Homo sapiens defensin, beta 113 (DEFB113), 20 µg
View other "DEFB113" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216994 representing NM_001037729
Red=Cloning site Green=Tags(s) MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKP IINKITSKLHQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 9.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001032818 |
| Locus ID | 245927 |
| UniProt ID | Q30KQ7 |
| Refseq Size | 249 |
| Cytogenetics | 6p12.3 |
| Refseq ORF | 246 |
| Synonyms | DEFB-13 |
| Summary | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. [provided by RefSeq, Oct 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421980 | DEFB113 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421980 | Transient overexpression lysate of defensin, beta 113 (DEFB113) |
CNY 3080.00 |
|
| PH316994 | DEFB113 MS Standard C13 and N15-labeled recombinant protein (NP_001032818) |
CNY 14250.00 |
其它DEFB113产品
