Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein
CAT#: TP316986
Recombinant protein of human acyl-CoA thioesterase 9 (ACOT9), transcript variant 1, 20 µg
View other "Acyl CoA Thioesterase 9" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216986 representing NM_001037171
Red=Cloning site Green=Tags(s) MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEACSSIHVNHVRDKLREIVGASTNWRDHVKAM EERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMH NKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATF VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDP KTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVD DIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGE SMLYLDGQRHFNSMSGPATLRKDYLVEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001032248 |
| Locus ID | 23597 |
| UniProt ID | Q9Y305 |
| Refseq Size | 1727 |
| Cytogenetics | Xp22.11 |
| Refseq ORF | 1344 |
| Synonyms | ACATE2; CGI-16; MT-ACT48; MTACT48 |
| Summary | The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421928 | ACOT9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY421928 | Transient overexpression lysate of acyl-CoA thioesterase 9 (ACOT9), transcript variant 1 |
CNY 4840.00 |
|
| PH316986 | ACOT9 MS Standard C13 and N15-labeled recombinant protein (NP_001032248) |
CNY 19520.00 |
其它Acyl CoA Thioesterase 9产品
