HAO1 (NM_017545) Human Recombinant Protein
CAT#: TP316834
Recombinant protein of human hydroxyacid oxidase (glycolate oxidase) 1 (HAO1), 20 µg
View other "HAO1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216834 protein sequence
Red=Cloning site Green=Tags(s) MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQR VSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVT KKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVA KAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVE AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ NVKVIDKTLVRKNPLAVSKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060015 |
| Locus ID | 54363 |
| UniProt ID | Q9UJM8 |
| Refseq Size | 1746 |
| Cytogenetics | 20p12.3 |
| Refseq ORF | 1110 |
| Synonyms | GOX; GOX1; HAOX1 |
| Summary | This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413692 | HAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413692 | Transient overexpression lysate of hydroxyacid oxidase (glycolate oxidase) 1 (HAO1) |
CNY 3080.00 |
|
| PH316834 | HAO1 MS Standard C13 and N15-labeled recombinant protein (NP_060015) |
CNY 19520.00 |
|
| TP720251 | Recombinant protein of human hydroxyacid oxidase (glycolate oxidase) 1 (HAO1) |
CNY 1800.00 |
|
| TP760664 | Purified recombinant protein of Human hydroxyacid oxidase (glycolate oxidase) 1 (HAO1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
