Annexin VI (ANXA6) (NM_004033) Human Recombinant Protein
CAT#: TP316809
Recombinant protein of human annexin A6 (ANXA6), transcript variant 2, 20 µg
View other "Annexin VI" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216809 representing NM_004033
Red=Cloning site Green=Tags(s) MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDL IADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYER DLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQH LRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVS RSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVAR VELKGTVRPANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALS SDTSGHFRRILISLATGHREEGGENLDQAREDAQEIADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEF IKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLN IRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 75.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004024 |
| Locus ID | 309 |
| UniProt ID | P08133 |
| Refseq Size | 2897 |
| Cytogenetics | 5q33.1 |
| Refseq ORF | 2001 |
| Synonyms | annexin A6; annexin VI; annexin VI (p68); ANX6; calcium-binding protein p68; calelectrin; calphobindin II; CBP68 |
| Summary | Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400463 | ANXA6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418290 | ANXA6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400463 | Transient overexpression lysate of annexin A6 (ANXA6), transcript variant 1 |
CNY 3080.00 |
|
| LY418290 | Transient overexpression lysate of annexin A6 (ANXA6), transcript variant 2 |
CNY 4840.00 |
|
| PH316809 | ANXA6 MS Standard C13 and N15-labeled recombinant protein (NP_004024) |
CNY 19520.00 |
|
| TP720183 | Recombinant protein of human annexin A6 (ANXA6), transcript variant 1 |
CNY 1800.00 |
|
| TP761425 | Purified recombinant protein of Human annexin A6 (ANXA6), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Annexin VI产品
