Aspartate beta hydroxylase (ASPH) (NM_004318) Human Recombinant Protein
CAT#: TP316796
Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 1, 20 µg
View other "Aspartate beta hydroxylase" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216796 representing NM_004318
Red=Cloning site Green=Tags(s) MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSV AVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEP QNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEH SYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVT APPEDNPVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEK LRKRGKIEEAVNAFKELVRKYPQSPRARYGKAQCEDDLAEKRRSNEVLRGAIETYQEVASLPDVPADLLK LSLKRRSDRQQFLGHMRGSLLTLQRLVQLFPNDTSLKNDLGVGYLLIGDNDNAKKVYEEVLSVTPNDGFA KVHYGFILKAQNKIAESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVW QRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDEGLAVMDKAKGLFLPEDENLREKGDWSQFTL WQQGRRNENACKGAPKTCTLLEKFPETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRFRMHLGLVIPKEGC KIRCANETKTWEEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 85.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004309 |
| Locus ID | 444 |
| UniProt ID | Q12797 |
| Refseq Size | 2452 |
| Cytogenetics | 8q12.3 |
| Refseq ORF | 2274 |
| Synonyms | AAH; BAH; CASQ2BP1; FDLAB; HAAH; JCTN; junctin |
| Summary | This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410099 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410101 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418063 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431238 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410099 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 3 |
CNY 3080.00 |
|
| LY410101 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 2 |
CNY 3080.00 |
|
| LY418063 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 1 |
CNY 4840.00 |
|
| LY431238 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 8 |
CNY 3080.00 |
|
| PH311817 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115855) |
CNY 19520.00 |
|
| PH316796 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_004309) |
CNY 19520.00 |
|
| PH323930 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115857) |
CNY 19520.00 |
|
| TP311817 | Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP323930 | Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP328203 | Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 11, 20 µg |
CNY 2900.00 |
|
| TP328230 | Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 10, 20 µg |
CNY 2900.00 |
其它Aspartate beta hydroxylase产品
