CDC42 (NM_044472) Human Recombinant Protein
CAT#: TP316559L
Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
货期*
4周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216559 representing NM_044472
Red=Cloning site Green=Tags(s) MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE TAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRKCCIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_426359 |
Locus ID | 998 |
UniProt ID | P60953 |
Refseq Size | 1135 |
Cytogenetics | 1p36.12 |
Refseq ORF | 573 |
Synonyms | CDC42Hs; G25K; TKS |
Summary | The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. [provided by RefSeq, Apr 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Axon guidance, Chemokine signaling pathway, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Fc gamma R-mediated phagocytosis, Focal adhesion, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, Pancreatic cancer, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Tight junction, VEGF signaling pathway |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...