PIST (GOPC) (NM_020399) Human Recombinant Protein
CAT#: TP316529
Recombinant protein of human golgi associated PDZ and coiled-coil motif containing (GOPC), transcript variant 1, 20 µg
View other "PIST" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216529 representing NM_020399
Red=Cloning site Green=Tags(s) MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKM TSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQS ADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYL DKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKS QGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHK EAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_065132 |
| Locus ID | 57120 |
| UniProt ID | Q9HD26 |
| Refseq Size | 4604 |
| Cytogenetics | 6q22.1 |
| Refseq ORF | 1386 |
| Synonyms | CAL; dJ94G16.2; FIG; GOPC1; PIST |
| Summary | This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412502 | GOPC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY412502 | Transient overexpression lysate of golgi-associated PDZ and coiled-coil motif containing (GOPC), transcript variant 1 |
CNY 4840.00 |
|
| PH316529 | GOPC MS Standard C13 and N15-labeled recombinant protein (NP_065132) |
CNY 19520.00 |
