SPANXN4 (NM_001009613) Human Recombinant Protein
CAT#: TP316287
Recombinant protein of human SPANX family, member N4 (SPANXN4), 20 µg
View other "SPANXN4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216287 protein sequence
Red=Cloning site Green=Tags(s) MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENN QPTESSTDPIKEKGDLDISAGSPQDGGQN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001009613 |
| Locus ID | 441525 |
| UniProt ID | Q5MJ08 |
| Refseq Size | 431 |
| Cytogenetics | Xq27.3 |
| Refseq ORF | 297 |
| Synonyms | CT11.9 |
| Summary | This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members. [provided by RefSeq, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422927 | SPANXN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422927 | Transient overexpression lysate of SPANX family, member N4 (SPANXN4) |
CNY 3080.00 |
|
| PH316287 | SPANXN4 MS Standard C13 and N15-labeled recombinant protein (NP_001009613) |
CNY 19520.00 |
其它SPANXN4产品
