CYP26A1 (NM_000783) Human Recombinant Protein
CAT#: TP316278
Recombinant protein of human cytochrome P450, family 26, subfamily A, polypeptide 1 (CYP26A1), transcript variant 1, 20 µg
View other "CYP26A1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216278 representing NM_000783
Red=Cloning site Green=Tags(s) MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVI MRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQL VEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWE RGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEIL EQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARF THFHGEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000774 |
| Locus ID | 1592 |
| UniProt ID | O43174 |
| Refseq Size | 2099 |
| Cytogenetics | 10q23.33 |
| Refseq ORF | 1491 |
| Synonyms | CP26; CYP26; P450RAI; P450RAI1 |
| Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, P450, Transmembrane |
| Protein Pathways | Retinol metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400267 | CYP26A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC409260 | CYP26A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400267 | Transient overexpression lysate of cytochrome P450, family 26, subfamily A, polypeptide 1 (CYP26A1), transcript variant 1 |
CNY 4840.00 |
|
| LY409260 | Transient overexpression lysate of cytochrome P450, family 26, subfamily A, polypeptide 1 (CYP26A1), transcript variant 2 |
CNY 4840.00 |
|
| PH316278 | CYP26A1 MS Standard C13 and N15-labeled recombinant protein (NP_000774) |
CNY 19520.00 |
其它CYP26A1产品
