PLA2G1B (NM_000928) Human Recombinant Protein
CAT#: TP316089
Recombinant protein of human phospholipase A2, group IB (pancreas) (PLA2G1B), 20 µg
View other "PLA2G1B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216089 representing NM_000928
Red=Cloning site Green=Tags(s) MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTH DNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNL DTKKYCQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000919 |
| Locus ID | 5319 |
| UniProt ID | P04054 |
| Refseq Size | 585 |
| Cytogenetics | 12q24.31 |
| Refseq ORF | 444 |
| Synonyms | PLA2; PLA2A; PPLA2 |
| Summary | This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400342 | PLA2G1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400342 | Transient overexpression lysate of phospholipase A2, group IB (pancreas) (PLA2G1B) |
CNY 3080.00 |
|
| PH316089 | PLA2G1B MS Standard C13 and N15-labeled recombinant protein (NP_000919) |
CNY 19520.00 |
其它PLA2G1B产品


