ATG4C (NM_032852) Human Recombinant Protein
CAT＃: TP316088
Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 7, 20 µg
View other "ATG4C" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216088 representing NM_032852
Red=Cloning site Green=Tags(s) MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDH VIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALN IENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLA LFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMT SDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116241 |
| Locus ID | 84938 |
| UniProt ID | Q96DT6 |
| Refseq Size | 1822 |
| Cytogenetics | 1p31.3 |
| Refseq ORF | 1374 |
| Synonyms | APG4-C; APG4C; AUTL1; AUTL3 |
| Summary | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Protease |
| Protein Pathways | Regulation of autophagy |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403599 | ATG4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409886 | ATG4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403599 | Transient overexpression lysate of ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8 |
CNY 3080.00 |
|
| LY409886 | Transient overexpression lysate of ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 7 |
CNY 3080.00 |
|
| PH305955 | ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_835739) |
CNY 19520.00 |
|
| PH316088 | ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_116241) |
CNY 19520.00 |
|
| TP305955 | Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8, 20 µg |
CNY 2900.00 |
