Estrogen Related Receptor beta (ESRRB) (NM_004452) Human Recombinant Protein
CAT#: TP315995
Purified recombinant protein of Homo sapiens estrogen-related receptor beta (ESRRB), 20 µg
View other "Estrogen Related Receptor beta" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215995 representing NM_004452
Red=Cloning site Green=Tags(s) MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGT PCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCP ATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLT KIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAW MEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP MHKLFLEMLEAKAWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPLPPPPSVAWVGTAQAGYHLEVFL PQRAGWPRAA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004443 |
| Locus ID | 2103 |
| UniProt ID | O95718 |
| Refseq Size | 2193 |
| Cytogenetics | 14q24.3 |
| Refseq ORF | 1500 |
| Synonyms | DFNB35; ERR2; ERRb; ERR beta-2; ERRbeta2; ESRL2; NR3B2 |
| Summary | This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401414 | ESRRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC432280 | ESRRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401414 | Transient overexpression lysate of estrogen-related receptor beta (ESRRB) |
CNY 4840.00 |
|
| LY432280 | Transient overexpression lysate of estrogen-related receptor beta (ESRRB) |
CNY 3080.00 |
|
| PH315995 | ESRRB MS Standard C13 and N15-labeled recombinant protein (NP_004443) |
CNY 14250.00 |
其它Estrogen Related Receptor beta产品
